PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000328589
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NF-YB
Protein Properties Length: 182aa    MW: 19201.7 Da    PI: 5.0357
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000328589genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB182.24.2e-5733129197
          NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                    vreqdr+lPian+srimkk+lP+n+ki+kdak+tvqecvsefisfvtseasdkcq+ekrktingddllwa+atlGfedy+epl++yl++yre+eg+
  MDP0000328589  33 VREQDRYLPIANISRIMKKALPTNGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEPLRIYLARYRETEGD 128
                    69********************************************************************************************99 PP

          NF-YB  97 k 97 
                     
  MDP0000328589 129 A 129
                    6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.2E-5431139IPR009072Histone-fold
SuperFamilySSF471136.52E-4036140IPR009072Histone-fold
PfamPF008082.9E-2839103IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.3E-206785No hitNo description
PROSITE patternPS0068507086IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.3E-2086104No hitNo description
PRINTSPR006151.3E-20105123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MAEAPTSPAG GSHESGGEQS PQGGGGGGGG SGVREQDRYL PIANISRIMK KALPTNGKIA  60
KDAKDTVQEC VSEFISFVTS EASDKCQKEK RKTINGDDLL WAMATLGFED YIEPLRIYLA  120
RYRETEGDAK GSARGGDGSS KGNAVXAMPG PSAQFVHQGA LNYGNPQEDY YVPLNNMGNG  180
SX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A6e-4832124193NF-YB
4awl_B6e-4832124294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A6e-4832124294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.167920.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008343495.11e-131PREDICTED: nuclear transcription factor Y subunit B-1-like
RefseqXP_008368957.11e-131PREDICTED: nuclear transcription factor Y subunit B-1-like
SwissprotQ8VYK42e-77NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLM5XKX81e-107M5XKX8_PRUPE; Uncharacterized protein
STRINGPOPTR_0008s04440.18e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.33e-73nuclear factor Y, subunit B8